DPCstruct | MC14572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 21 aa |
| Standard deviation of domain lengths | 20.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 60.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4SWY3 | 103-225 | NALATLSSISEDPTFASEYIKRNGLVLLLSMVEGKPESNESLANCLTSFQELMDHGEVSWDFLTHGFIKNLTVFVNKKNPPVDSTVL… |
| A0A060YUJ6 | 2-100 | EGIGTLARLVESGTHFGEMLAFTLTAFLELMDHGIVSWDLISLSFIKQIASYVNQPMVDVSILQRSLAILESMVLNSHSLYHRVAQE… |
| A0A6F9CPH3 | 1-138 | None |
| A0A6F9AH38 | 2-79 | None |
| A0A803V2Z8 | 12-91 | None |
| A0A315UY06 | 221-355 | None |
| A0A444UUH0 | 18-115 | None |
| A0A6A4TE37 | 429-550 | None |
| I7GL86 | 6-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.