DPCstruct | MC14571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 15.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6BM78 | 368-455 | GDEVGMLEDMEVGVADLSEVAFAVTEAKTEQPDDLLPTLRGTWGSFVVEVPLTTEMFGPLPQELKEGRLIRVHPVLFNIGINQQQSLA |
| A0A060YTU0 | 1-128 | MLEDMEVGISDLHRVAFKITQAKTDNPCDLQPVVIGRRDHYTVEVPLPRLAFQTLPHEIKEGKALQVYPVLFNVGINEQQTIADRYR… |
| A0A1S3MSL2 | 1-89 | None |
| A0A6I9NA60 | 1-87 | None |
| A0A6G0HJV2 | 756-863 | None |
| A0A4W6EWU1 | 491-579 | None |
| A0A3B4AQ21 | 552-658 | None |
| A0A820X461 | 13-86 | None |
| A0A6I9Z1M4 | 126-208 | None |
| Q3LAC4 | 1322-1402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.