DPCstruct | MC14570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3FYN4 | 47-130 | TAELLLRVCADIAAQLVDAHDRSASVSLNHIRTTTCKRYGFNGVPRLTDIIAAIPEAYRKALVPALKAKPVRSASGIAVVAVMC |
| A0A060YRV9 | 12-88 | RAELMMMTIADVINQLVEAHEEGKDINLNKVKTKCSAKYGLSAQPRLVDIIAAVPPHYRRALVPKLKAKPIRTASGV |
| A0A814Z2U0 | 11-93 | None |
| A0A183NAF2 | 1-98 | None |
| A0A7I8XDV9 | 207-282 | None |
| D8RL82 | 192-271 | None |
| A0A0R3TD52 | 2-89 | None |
| A0A388KW21 | 21-110 | None |
| A0A2G2X857 | 29-103 | None |
| A0A1R0GUE2 | 302-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.