DPCstruct | MC14569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 16.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2CS64 | 506-646 | WASLKWIGRYPELAFRFMQTWGIVMVLDPIITIGEALIWGFVYGYWGIDPFRLYNYFERAEGNGVVGVLLTIFLYAGLMGLCAFVVY… |
| H2XRF8 | 425-574 | VLFSWVSQKALGSFPLIFSKLILAFSLWVVFDPIMILIVDAALGRYTNSASQPIGDAFKLYWHFLRVEGSGVIGIPMVIFLYAVVMF… |
| A0A5C6NVP1 | 109-262 | None |
| A0A7F8K4C8 | 598-788 | None |
| A0A0N8JW20 | 71-206 | None |
| E4X9D4 | 206-357 | None |
| A0A061ICD6 | 252-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.