DPCstruct | MC14568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 230 ± 44 aa |
| Standard deviation of domain lengths | 44.47 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 89.91 |
| Assigned Pfam label(s) | CL0081- PF05033- CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060YRB8 | 10-264 | IPTPGGSRTGLASNSHAPKAMQPQPPTGSPGNSSRMYVLQTGNIQTLTSLQPIQHQQQSLPPPPQAPPTAPAPAVTPYTFSNDRIPH… |
| A0A444UQL6 | 1-181 | MPLEPSYQAPSEKLFYVPHSCGPGCLDRLRPARLDQFRGRNPLLVPLLYDFRRMTGRRRVNRKMWFHVIYKSPCGLSLRSMPEIERY… |
| A0A834XWM4 | 370-649 | None |
| A0A183HNB6 | 5-183 | None |
| A0A2Y9NGA1 | 67-283 | None |
| A0A3Q0KPQ6 | 413-710 | None |
| A0A3Q0KQ18 | 54-355 | None |
| A0A818FGV1 | 1-207 | None |
| A0A2J8VSC4 | 69-291 | None |
| B4XVP4 | 50-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.