DPCstruct | MC14565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 78.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1CWE8 | 1-66 | RARYNPYIQARARVDQLRRLGHSVDKVEFILMGGTFMSLPAEYRDYFIRNLHDALSGHSSENVAEA |
| A0A060YP32 | 1-72 | MRAVGARSDPYRQTRHRVEQLKQLGHSVDKVEFIVMVGTFMALAEEYRDYFIRNLHDALSGHTSNNVAEAVR |
| A0A0T6AY25 | 27-112 | None |
| A0A835I3J6 | 15-82 | None |
| A0A2B4SIX6 | 1-70 | None |
| A0A1E5V126 | 31-110 | None |
| A0A815XC62 | 33-120 | None |
| A0A4U5MTB7 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.