DPCstruct | MC14563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016S4P6 | 1-61 | MSVREVRIWKRTDVRQPPAVLIDRNSVDCSLLIQNDGIATLDSDSAEVERRGYTKIMDSYG |
| A0A315VHB7 | 726-791 | MAFSKGYRIYHKLDPPPYSVIVETRAREECLMFESGAVAVLSAAEKDAIKSTYTKIFDAYGILGVL |
| A0A5N5THZ4 | 1-77 | None |
| A0A670I6R8 | 1-73 | None |
| A0A4W2EM92 | 1-62 | None |
| A0A2H2JMM0 | 1-68 | None |
| A0A6P7QG39 | 1-62 | None |
| A0A183PKU0 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.