DPCstruct | MC14562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 17.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.40 |
| Pfam Score | 86.03 |
| Assigned Pfam label(s) | CL0020- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6P6L9 | 1-114 | MNFIIQEAESIGCMVELLSHCEVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIQQVLLKMSTVDDMIADLLVDMLGVMASYSITVKE… |
| A0A060YLZ1 | 1-140 | MNFIIQEKDSIVCMVELLDKCEPTCQAEVWSIFTAILKKSVRNLQACTDTALINMVLDRVAHTDSMIADLMVDMLGVLASYSITVKE… |
| A0A0V0XHR6 | 92-243 | None |
| A0A287XNR9 | 1-134 | None |
| A0A2G8LA92 | 4-134 | None |
| A0A821HSE9 | 1-124 | None |
| H0XPV2 | 1-126 | None |
| A0A821GLC9 | 117-258 | None |
| A0A0P4WMF8 | 29-190 | None |
| A0A1D6LPL5 | 692-843 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.