DPCstruct | MC14561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 502 ± 52 aa |
| Standard deviation of domain lengths | 52.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 92.22 |
| Assigned Pfam label(s) | CL0001- PF06008- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3LFN1 | 3-478 | CLCMPGYAGPKCARCAPGFYGNPMVIGSTCQPCHCHDNTDPNMLFSDCDGLTGECHSCMHNTAGAHCEICAPGFHGDAITAKNCTRC… |
| A0A060YHN0 | 184-642 | CMCYSVGTMSEACLSPGECHCDLQTGQCPCRPNVIGQNCDRCALDTFNIGSGKGCQTCDCDPTHSFGTSCNELSGQCSCRSGFGGRK… |
| A0A4W5MRY1 | 72-534 | None |
| A0A3Q3AII8 | 31-534 | None |
| A0A5J5CMT1 | 2-488 | None |
| A0A2G8KZJ0 | 22-505 | None |
| Q16363 | 65-583 | None |
| A0A3P7F3G4 | 372-824 | None |
| G3NJJ9 | 3-552 | None |
| A0A6I9N757 | 86-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.