DPCstruct | MC14560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 241 ± 52 aa |
| Standard deviation of domain lengths | 52.07 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 79.86 |
| Assigned Pfam label(s) | CL0023- CL0220- PF08393- PF17852- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5A5C9 | 1-126 | MITEEHLRSLMFGDYMDPDAFAEDRRYEEVKDINRLYPIAEHYLNDFNSSNKNKMNLVIFRYVLEHLSRISRILRSPGGNALLVGVG… |
| A0A060YGI1 | 463-710 | LFTPCVLTQWVLSLLRYDLSAGNCNITDSVLEVVAYEAKRLFRDRLVSSKDIHSFDNILSSVIRGDWGSDALDNMTDGFYVTWGASE… |
| A0A812LF56 | 585-891 | None |
| A0A0N4VVJ1 | 25-264 | None |
| A0A7J6UIT8 | 218-482 | None |
| A0A813PS57 | 23-267 | None |
| A0A5J4V7Y4 | 143-389 | None |
| T1GEP1 | 8-169 | None |
| E7FFM4 | 824-1103 | None |
| A0A821HPW7 | 10-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.