DPCstruct | MC1456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 325 ± 39 aa |
| Standard deviation of domain lengths | 38.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 33.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B5BEU1 | 535-862 | KTPVFYTFTANRSSGDDTTGKYYFGCSNCHPLTNSNHTSGTIVLDFRPTTTGISTLKAKNSATITAFGPVGTANGGTSGTSGSSVVC… |
| A0A2N2G6Y3 | 1-258 | MNNTVEVDLTASAAGGHLKANNGASAAMNGAKQCLNVYCHSNGYSANVQYATTPAWGGSFPDDKCSNCHGNSPGVNIAGSTAHSAHV… |
| A0A212PGP0 | 516-821 | None |
| A0A212PGI9 | 892-1265 | None |
| A0A0A8WW57 | 1-331 | None |
| A0A2N6FD91 | 688-968 | None |
| A5GCG7 | 65-379 | None |
| A0A1G0M9W6 | 213-605 | None |
| A0A1G0LRX2 | 784-1093 | None |
| Q2IMF7 | 205-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.