DPCstruct | MC14559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060YFV5 | 1-87 | MQWYQDELLHMAKDVGLRLLPAFNTSSGLPYPRVNLKHGLRSPESRTGTETDTCTACAGTIILEFAALSRFTGDPVFEVKTDNHLLL |
| A0A835UQ17 | 143-222 | IESYNDELLHLAEDLARRMLPAFETPTGIPFGSVNLLHGVDEHESKITATAGGGTLTLEFGVLGRLTNNSVFEQITKNAV |
| A0A060BLM4 | 1-83 | None |
| T1GPE1 | 77-148 | None |
| A0A5K4FBP9 | 155-235 | None |
| A0A0D9VKV4 | 169-246 | None |
| A0A3Q0IWM0 | 215-292 | None |
| A0A7S1ZB44 | 50-128 | None |
| A0A368FRC2 | 31-113 | None |
| A0A453PL11 | 28-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.