DPCstruct | MC14553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 184 |
|---|---|
| Mean domain length (aa) | 258 ± 59 aa |
| Standard deviation of domain lengths | 59.46 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 64.15 |
| Assigned Pfam label(s) | CL0114- PF08676- PF16413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838VS42 | 4-170 | FLKAIAQVQNTYIVAEHPGGIWLVEQHIAHERVLYEQLSDAWQLITAETPIILPQLSTEQVLQLQRIGLDIELFGEQVWVVRTIPAM… |
| A0A7S1HR62 | 44-300 | GCPCGGGAGSDGGGFGGPSVRPAFATNALTQSDVSSVGTLGFLGKSLLPGQVTREMVGSSKLIGQVDRKWIAATCGGGRTLVLFDQH… |
| A0A498P3R3 | 2-223 | None |
| A0A7V6WGH0 | 75-321 | None |
| A0A7R9A0P6 | 754-1031 | None |
| A0A1X6PEX5 | 8-156 | None |
| A0A843D2P1 | 182-429 | None |
| F4PI82 | 563-857 | None |
| A0A0B7N1B8 | 84-414 | None |
| A0A7R8XAI6 | 811-1155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.