DPCstruct | MC14550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 213 ± 48 aa |
| Standard deviation of domain lengths | 48.14 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9E9B0 | 1-159 | MNITPLDIRKQEFNRKMRGYDPEEVQGFLDQVATALEASNAMVAELEERLKESESRLGHYRLIEQNLQDAALTVQRSLDETKRLAEK… |
| S2NX51 | 1-218 | MALSPLDIHNKEFSSKMRGYDKDEVNDFLAQIVKDYSSLIKDNEGLKKELADAKEKVQYFTDMKEALNQSIIVAQESAEKVKNSAHQ… |
| A0A316QDA9 | 33-268 | None |
| A0A1T1D992 | 1-171 | None |
| X1HMP7 | 32-176 | None |
| A0A523EGS4 | 11-166 | None |
| K6DE71 | 56-209 | None |
| A0A2V7KXW3 | 29-180 | None |
| A0A2T2UUJ4 | 1-225 | None |
| A0A1I0P1H6 | 1-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.