DPCstruct | MC1455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 141 ± 8 aa |
| Standard deviation of domain lengths | 8.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06242 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6U3A3 | 35-170 | EIQAIADDMAATKLTGRDPVRAGELAMSEIEKGQANPAYRLVMLKGPDQVRRTKGPRYTPVSKRQDKPDGISWIIRNHPEVSDGQIS… |
| A0A2H0QEB9 | 1-138 | MADNPIKSGQITREEVERCEKDHEAKLKLSKEAAEYMASNKRKGARYTPVARRQDKPDAISWLLKHHPELSDPQIVKLVGTTKNTIT… |
| A0A1Q6UD73 | 30-180 | None |
| A0A833D154 | 1-147 | None |
| W6TD82 | 83-215 | None |
| H6SRU2 | 124-277 | None |
| A0A1E5A751 | 41-170 | None |
| A0A7Y6YWH0 | 35-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.