DPCstruct | MC14549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 133 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024YHP3 | 2-147 | TTMDLTKTPPALATEAAEAIRALNHLTIGLDHKGYENPAEAGATAYALRTLAERLPQTLDQLSTALVRFANEDAIRMDDGTDPIQAV… |
| A0A385FX31 | 5-118 | KTPEAVQEADTAYDALRALAHLTRATHPAPVVYGILGNLKNLGSFLPQISEQLAHGLVKSLEEYDVTEDSGKDPAASVALAGEHLAR… |
| A0A6L9QVB2 | 13-145 | None |
| A0A1A9D3C8 | 1-137 | None |
| A0A1X7HGY5 | 1-124 | None |
| C8XCT1 | 1-127 | None |
| A1SJ10 | 36-179 | None |
| A0A372LXJ7 | 1-132 | None |
| A0A2N3UTD0 | 9-150 | None |
| A0A640UHV6 | 21-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.