DPCstruct | MC14545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 240 ± 21 aa |
| Standard deviation of domain lengths | 20.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9JRB4 | 543-780 | YISQENDKEAHLIPDHTIRALGHIAVAMRDSPKVMEPILQILQQKFCQPPSPLDVLIIDQLGCMIITGNQYIYQEVWNLFQQISVKA… |
| A0A438CDU9 | 16-270 | KQATPVVQLNVIRLLADLNVSINKSEVVDMILPLFIESLEEGDASTPSSLRLRILDAASRMASLGFEKSYRETVVLMTRSYLSKLSS… |
| A0A4W6BHU6 | 225-462 | None |
| A0A177TF52 | 2-238 | None |
| W2ST04 | 3-221 | None |
| A0A3P7EVW6 | 496-723 | None |
| A0A0Q3MYA9 | 410-673 | None |
| A0A7T8KKK5 | 165-395 | None |
| A0A3P7ILG9 | 1-196 | None |
| M8BST1 | 205-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.