DPCstruct | MC14544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0WVF6 | 1-58 | IWDTHERGKPDMVKLAYRAVVETGAEAVICISNKQLTWQVVSGMESRGIPAYGAIWDS |
| A0A438C6L6 | 73-151 | SLIVCFLRSIIFLAVLMEMVIVRDTAVCGRPNVAKMSVETAQSWKAEVVVVTSNPHGSRDVIGAWRAAGLTAFGPIWDS |
| A0A6A6IHW2 | 114-180 | None |
| A0A2P5A445 | 124-192 | None |
| A0A151SEN6 | 281-349 | None |
| A0A0G4M3K2 | 685-751 | None |
| A0A137Q3J2 | 425-491 | None |
| A0A4V3X9J1 | 1-82 | None |
| A0A444Z5K8 | 107-185 | None |
| A8NS27 | 959-1025 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.