DPCstruct | MC14543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 6.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 64.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 70.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438FGW7 | 1-73 | MEHLLTPRDFFYPRIAMDFYQSMTTKQVRNPTLIHFTIDGRHGILGARHIAEALQIPYEPSHFDDFRAWTSHT |
| A0A438C624 | 1-73 | MEQLLTPRDFFYPRVAMDFYQSMTTHHVRDPTVIHFTIDGRHGILGARHIAETLRIPYEPARQRIIEYGLILP |
| A0A438GK49 | 1-69 | None |
| A0A438GJI2 | 19-79 | None |
| A0A438GB93 | 1-61 | None |
| A0A438EJ52 | 1-52 | None |
| A0A438C609 | 103-169 | None |
| A0A438GYI7 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.