DPCstruct | MC14542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 58.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438C370 | 9-99 | VLRLILNRVFPPCFHLIHENYDQLNKAFAGTDHSWTALTLKLCTALQTANTLVQSTNTKVELLSEKVGELERVVKRGDSAVAAAKAI… |
| A0A1Q3CVB3 | 49-128 | DLPKLFQENYDQLNEALAGTDHSWTSLTLKLCTALETANKLVQSTNMNARQLSEKVGELEKIIKRGDSAVAAAKAIHVSK |
| A0A7J9HF74 | 5-95 | None |
| A0A834ZHC7 | 64-146 | None |
| A0A7J6F6F9 | 45-125 | None |
| A0A3S3QGN0 | 53-141 | None |
| A0A7I8J3Z7 | 42-129 | None |
| A0A7J7D0A4 | 4-94 | None |
| A0A835DI08 | 57-149 | None |
| A0A5N6RES6 | 539-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.