DPCstruct | MC14540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 487 ± 97 aa |
| Standard deviation of domain lengths | 97.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433JZR5 | 45-590 | WKQLHLKKTAAESFHYVHDMVSLEQAQQDSFPKLEKFLLDPKTLRVTRELLIHLEQTKDIILPSRMSLSNVYRAERQFLTAYMIATK… |
| A0A438BVL3 | 38-554 | MPFEKLALQMESANTIQTVKALLDRFESRLMISHAATPTRSLSNLENIDNLLMRVTSPKRRGNTNNRGVNRVGSIREGAQRQVKLSR… |
| A0A287TVL0 | 97-618 | None |
| A0A061DZF0 | 211-853 | None |
| A0A0A0KGG6 | 342-968 | None |
| A0A287II90 | 2-455 | None |
| X6MN76 | 38-539 | None |
| A0A1D6Q380 | 189-819 | None |
| A0A3L6PYB3 | 2-388 | None |
| A0A2G5DBM5 | 1-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.