DPCstruct | MC14539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 300 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9RLV7 | 97-366 | LNGRLWAGHNVQKFDSVKIREAFAEIGRQPPVPKGVIDTWELLTHKFGRRAGDMKMASLATYFGLGKQTHRSLDDVRMNVDVLKCCA… |
| A0A438BUT6 | 3-330 | TGRIWAGHNILRFDCARIREAFAEIGRPAPEPKGSIDSLALLTQRFGRRAGDMKMATLATYFGLGQQTHRSLDDVRMNLEVLKYCAT… |
| A0A0E0QYX8 | 519-820 | None |
| A0A6J1AI80 | 94-432 | None |
| A0A1D6K817 | 6-288 | None |
| A0A200QEP4 | 92-416 | None |
| A0A0D3EH74 | 391-696 | None |
| B4FMU1 | 1-287 | None |
| A0A834Y7S8 | 92-385 | None |
| A0A7G2FD43 | 90-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.