DPCstruct | MC14536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 161 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 73.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 59.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7KFW1 | 92-252 | NDSQICTWCARTLSSLTARSRQEDRYGVAQLTGCNAAVMSTLLSALVAVEACLGKKTNPQPAHSLGPASIKWANFSTGRKGNVTAIA… |
| A0A438BR42 | 45-206 | HENLLCAWCSWAVASLTARSHKEDRFGVAQLSSSNAAVISTLLSCLLAVETFLGKKTSLQSPNALMGLAGIKWATVTTARSDAATSV… |
| A0A7J9DPE3 | 68-235 | None |
| A0A4Y1RAU3 | 180-342 | None |
| A0A103Y921 | 132-294 | None |
| A0A0A9JJ44 | 12-172 | None |
| A0A396GDT3 | 10-151 | None |
| A0A2G2XWA7 | 683-843 | None |
| A0A6P5EMM2 | 193-352 | None |
| A0A6P6XE10 | 77-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.