DPCstruct | MC14530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5DL94 | 359-443 | VRAIEIADQSMVELLRSHAVRFDALTPAFGLSTEDGTEVATLEEADPAIQEAFEWLQSRGLAELLEETTGTCILLKGHALEFLNA |
| A0A7G8VM83 | 2-77 | TARAFEIADDSMFSLLINHCVIGDEHATILGLVDEAGIEVRSLAVADPNVIEAVEWLMPRGYVEVAADTDGEHVLV |
| A0A0P9BQE6 | 186-270 | None |
| A0A2S4MIN6 | 4-83 | None |
| A0A523A0Y0 | 91-178 | None |
| A0A6P2T205 | 144-233 | None |
| A0A3S0BRK0 | 79-157 | None |
| A0A5C7U6A3 | 18-104 | None |
| A0A6J5CL98 | 311-397 | None |
| A0A1J5NYX2 | 196-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.