DPCstruct | MC1453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6QX71 | 13-123 | FPVLYKCMSWGFQNGDGWYEIIRRLSISISNIVASASLEPSEFTVSEVKEKFGLLRVYISNTNNAIQDAIYQSVQESSRTCEKCGGP… |
| A0A7V8TZT5 | 66-177 | HVFEQHGYVVPADAEFACGKGWERVIRKLATGLSAIPGPPPRFYGGKEKFGSFIAFISCEGDQREEVQVLKEAARKQSLRVCDECGA… |
| A0A1H1MVE6 | 16-112 | None |
| A0A5K1S4N1 | 9-111 | None |
| A0A0Q6GF24 | 6-123 | None |
| A0A349Y117 | 1-102 | None |
| A0A4Y9LYZ4 | 7-107 | None |
| A0A5C7YKZ1 | 170-269 | None |
| A0A5C7YLW6 | 2-89 | None |
| A0A2G6YY22 | 22-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.