DPCstruct | MC14529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1294 |
|---|---|
| Mean domain length (aa) | 153 ± 25 aa |
| Standard deviation of domain lengths | 25.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.79 |
| Pfam Score | 94.76 |
| Assigned Pfam label(s) | CL0023- CL0481- CL0126- CL0109- CL0324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8VKJ1 | 10-166 | TPAPESGFASGTRIHTKQGLQPIEDIRAGDWVLTHAEQRPPPPRRRHHGEYQYRRVTLMTSVEVQSMVRVTLQNFADGIKDTLLVAP… |
| D0W6I4 | 2-122 | VKTADGYKAIAHIQTGEYVFAKDETSGKTGYKPVTARYGNPYRETVYIEVSDGIGNSQTLISNRIHPFYSDGKWIKAEDLKAGIRLL… |
| A0A2N0PTT4 | 255-421 | None |
| A0A2D7YW40 | 581-762 | None |
| A0A7K0BRU8 | 231-381 | None |
| A0A1P8WKC0 | 95-265 | None |
| A0A1M3Q885 | 354-507 | None |
| A0A1M3Q1A5 | 13-177 | None |
| B8IH48 | 524-656 | None |
| A0A1N7DGY0 | 32-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.