DPCstruct | MC14523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 58.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1LCZ8 | 5-93 | GVVPEETELAALLRVNADTGRADQVYRVLHRTRTLVRQVCEATAQVVEAWFRSDAAAEAGVEKWDARKVREGVVKGGGGWHGHGWLG… |
| M8BMW7 | 8-93 | PEETELAALLRVNADTGRADEVYRVLHRTRTLVRQVCEATAQVVEAWFRSDAAAEAGVEKWDARKVREGVVKGGGDWHGQGWLGKG |
| A0A5N5J8S8 | 1-93 | None |
| I3T310 | 4-93 | None |
| F6HAJ8 | 46-124 | None |
| M8BYR1 | 1-93 | None |
| A0A287MRD0 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.