DPCstruct | MC14522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 107 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06880 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5TLH8 | 1-98 | MYVTKPLSLYRRSPQSLSLPPPEGPNSGYLVLHDDESVEISCCGCADDRVKDLPFPQNKDLTVGYGSDDDEVTFIPVLSQPLSSNRY… |
| A0A164SSH8 | 1-101 | MYVTRPLSYYLNNSKSLSLPPEGPNSGYLVIQDEESEMYSCFGLCKNTDLNDLPFPQDKNLTTRYSSGEDTYHHNLAFFPVLNQPLS… |
| B8BAS3 | 1-112 | None |
| A0A6A3CYS8 | 1-112 | None |
| A0A078GMB8 | 1-107 | None |
| A0A834L885 | 487-592 | None |
| A0A7J6DPR8 | 493-603 | None |
| A0A445EWK6 | 1-108 | None |
| A0A0D9X7T0 | 461-575 | None |
| A0A0D9X7S7 | 11-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.