DPCstruct | MC14521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 165 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A2Z8C9 | 96-249 | QALVLFVNRKIIDIKDTLALFMELQTLDDRNLRKLAFSHVVHSIRRMNKNHKNEAMNRALQNVLFTLLQQEGEAKAKRSLITLSELH… |
| A0A6J5TKC6 | 1-173 | MVDMGDNLALFMELQTFGNKALRNLAYSHVVHSIKRMNQKHKNEVKNRALQNVLFEMLRKDETKAKRALITLRELHQRKLWFDERTA… |
| A0A835GXA8 | 26-186 | None |
| L1IY42 | 95-259 | None |
| A0A3B6CDL1 | 1-174 | None |
| A0A388JVX1 | 95-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.