DPCstruct | MC1452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 16.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6YN53 | 2-140 | PPPSPLPSLFLAEALLKVAGGAYFLLSPTTILTLTSTPPFPASARMLIQHLGSQTLAFSVPLFLAARSTPRAVASRRIVYWAVLARE… |
| A0A6A6QW80 | 27-174 | IKIDPSAPGTIGRIALAIEAAVKITVAFFLTFFPHLNFGPAVTDSSNLAPSTIALSQWIGVILIASAIQHALAIRNTRSALDSRHQV… |
| A0A423WTU9 | 2-136 | None |
| X0IQI2 | 1-137 | None |
| A0A5C6SMQ9 | 1-137 | None |
| A0A2V1D3K3 | 366-497 | None |
| A0A6A6G963 | 2-155 | None |
| N1PE34 | 44-221 | None |
| A0A1W5CXP4 | 16-130 | None |
| A0A6A6HPL5 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.