DPCstruct | MC14519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067KBG2 | 199-283 | MQTRVFIVHMSSSIGSRFFTKVREIGMMSEGYVWIITDGMTGLLSSLSPSVIDSMQGVLGVRPFIPKTKELENFRVRWKRKFLQD |
| A0A6J5TEB8 | 1-82 | MGMETRIFLVHMTASLGSKVFVHAKEAGIMSKGYAWITTAGLSTLLHPKMEEAKVTGSMEGVLGVRPYEVGKPKDEDIHLSK |
| A0A2I0HQ23 | 104-187 | None |
| A0A453KVT6 | 12-94 | None |
| A0A6A3CNZ5 | 3-70 | None |
| A0A6A6LL47 | 72-155 | None |
| A0A1R3KLK7 | 68-151 | None |
| A0A5N5I146 | 1-78 | None |
| A0A2U1QKQ5 | 4-82 | None |
| A0A804NX19 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.