DPCstruct | MC14517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1L9X3 | 245-374 | RQAEWCVDNGVTAMRWTFDPLQLTNAHLNLNKLGAFGVTYHTNHYGALGGINGSLPSDRLTVQWELERPRPAFAETFVLDVPAVSPE… |
| T1AFG0 | 15-162 | IAWTFDPIRSLNAHFNLNKLGAITRTLVPNFYGTMEDSLNAGIPTDRVVAEWWIKEKRVMPEGNSSVVLDVSKQDFNLQIEEITSFQ… |
| A0A1H0QK37 | 110-227 | None |
| A0A1W9VDX2 | 2-161 | None |
| A0A2V9U116 | 6-172 | None |
| A0A7V6WIK1 | 2-160 | None |
| A0A3P0XC70 | 196-337 | None |
| A0A1Y2KE48 | 1-134 | None |
| A0A819SAP3 | 150-300 | None |
| A0A4P5S4T2 | 33-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.