DPCstruct | MC14516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 156 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8Q8C2 | 6-161 | FLSAASGLAVIFALIRAFTRQSMSTLGNAWVDMLRITLWVLVPVALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEA… |
| T1ACT2 | 2-150 | FIAAGTGFAASMAFIRGIIKDDGKLGNFFHDFLVAIFELILPLSILATVIFILIGVPETTSSFLYIHPFFSKSVIGIPIGPVSSLEG… |
| A0A4S2S6E9 | 2-126 | None |
| A0A7V9PNG3 | 57-194 | None |
| A0A377GL00 | 134-354 | None |
| A0A1V4TRG9 | 355-540 | None |
| A0A2X1SS06 | 2-136 | None |
| A0A534N902 | 404-574 | None |
| A0A7I7SM77 | 122-288 | None |
| A0A534WFU0 | 115-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.