DPCstruct | MC14515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 314 ± 54 aa |
| Standard deviation of domain lengths | 54.14 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.63 |
| Pfam Score | 94.95 |
| Assigned Pfam label(s) | PF17392- CL0063- PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6DIY2 | 1-166 | PEDLVVYGGIGKAARNWESFDAIVDSLRNLEKDETLLVQSGKPVAVFKTHDQAPRVLLSNSVLVPKWANWEHFNELDKKGLMMYGQM… |
| T1ABY9 | 11-312 | RHIRAPHGPQKTCKNWVIEAAYRMIQNNLDAEVAENPAELVVYGGIGRAARNWECFDAILESLRELNEDETLLIQSGKPVGVFRTHT… |
| A0A0M3IGF3 | 82-431 | None |
| A0A535YS62 | 456-801 | None |
| A0A3P9KAA8 | 80-391 | None |
| A9WN96 | 237-577 | None |
| A0A820X0J8 | 83-318 | None |
| R7T502 | 35-359 | None |
| A0A268IJR8 | 1-240 | None |
| A0A521WL82 | 112-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.