DPCstruct | MC14512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I9VCK6 | 60-123 | PKKAFDYVVNGKSAIDWVIERYQIAKDKDSLIENNPNHYAGGKYVFELLCRVITLSVKSVDLIE |
| T0ZWJ9 | 1-69 | MVNGKPALDWVVERQCVKTDKASGIVNDANDWATETVGNPRYPLELFLRVITVSLETMKIVRALPALNL |
| A0A7T0PW65 | 49-130 | None |
| D7N3Y8 | 332-400 | None |
| A0A7I7MMF8 | 4-71 | None |
| A0A6B1BXW1 | 4-78 | None |
| A0A832HAM6 | 12-77 | None |
| A0A840NY11 | 2-58 | None |
| J0QI48 | 9-81 | None |
| A0A2I1J879 | 490-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.