DPCstruct | MC14510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 358 ± 71 aa |
| Standard deviation of domain lengths | 70.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8XSA8 | 2-249 | YGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAIS… |
| A0A180EUX9 | 2-347 | TALLVWVTEYYTATRYRPVRSIAQASTTGHATNIIQGLAVSMEATALPIIVISAGILVAYLSAGLYGIAIAATAMLALTGIVVTLDA… |
| A0A446K145 | 211-612 | None |
| A0A2G1C2M5 | 78-518 | None |
| A0A090VXS3 | 49-456 | None |
| A0A7S1XBJ6 | 51-563 | None |
| A0A804IRX9 | 2-298 | None |
| A0A7C2AEV6 | 125-509 | None |
| R7QL36 | 541-931 | None |
| U6KT54 | 3-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.