DPCstruct | MC1451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1112 |
|---|---|
| Mean domain length (aa) | 305 ± 64 aa |
| Standard deviation of domain lengths | 64.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 99.61 |
| Assigned Pfam label(s) | PF03595- PF06985- CL0071- CL0587- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813F9A7 | 44-301 | AGLKLVNELPCPLFLVSAEDFLSMPEEELRSLHEGLRPTGKLLTLDTMDEVVQLKKTSRILFFSYEWLSWSKVGPNKIQLLAMKAAA… |
| A0A6A6QFV6 | 23-346 | YAPLDASDAIRIITLLPAQSFEAPIHCQIRRTTFFGSSYEALSYAWGSNYREISIKCNDQDLFVTPNLLRALKRLRPIVTSNIPNPK… |
| A0A284QTR2 | 115-411 | None |
| A0A284QRZ4 | 446-737 | None |
| A0A146F3R6 | 280-500 | None |
| A0A284R2P4 | 509-766 | None |
| A0A0C9TX20 | 2-259 | None |
| A0A366REN6 | 494-807 | None |
| A0A6A7A9Y8 | 3-221 | None |
| A0A6A7A7Y8 | 9-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.