DPCstruct | MC14509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4DAM4 | 1-87 | MSDILVTKIMLGVFGNVPAFDTNFKKGFHVATFGPKALRKISAVYEEHSTVIDRYRTLTLDFVSGEPTSRKYTRAKVIDMAFFIEGM |
| A0A857A814 | 1-88 | MSPVLITKILMGTLGCVPAYDRFFQDGVAKYKVTTQEYSPESVLRLVDFYEAHNDRLEEVRRGMKRDDLIYPQMKVLDMGFWQIGFET |
| A0A645G9X1 | 4-106 | None |
| W4QZZ9 | 86-211 | None |
| I0ETD5 | 12-132 | None |
| A0A837AF04 | 2-95 | None |
| A0A429ZDE5 | 27-141 | None |
| A0A229UGI4 | 2-129 | None |
| A0A1L7CWQ4 | 160-269 | None |
| A0A1T0AAT5 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.