DPCstruct | MC14503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 313 ± 58 aa |
| Standard deviation of domain lengths | 58.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2G575 | 14-301 | NNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGLVMAFFPALA… |
| A0A841IJ32 | 2-334 | IKVGGSILMKVLTAFSTLFSSAFDIVGVVPSNEAIMAATIDQIGSTAAIILLFSMVINILLARFTRLKFIYLSLHLVLFMSFALTAV… |
| A0A844VW16 | 2-240 | None |
| A0A847VT54 | 4-388 | None |
| A0A5S9M9N5 | 2-277 | None |
| A0A828ZLU8 | 1-262 | None |
| U2R6F3 | 51-330 | None |
| A0A084U3Y5 | 74-501 | None |
| A0A448SZF9 | 56-315 | None |
| A0A828Y8Z5 | 47-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.