DPCstruct | MC14500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842Y932 | 1-107 | YGQVTTQRPIEIVTGQIGLDYGHRILMRLDIENNTPIVIEEERISKSEGEHGTMISFWLQGDWIRSKRRIIDYFAHTAIIVPYASLF… |
| D6PC07 | 1-106 | MYCQLTTGRKTHVRSKIATETSAAIVDIGLDTRKNKATKTSEGRELWERPDGTLKEHGLEITCRMKAKYQRGRQSVYQYLRMTSIVN… |
| A0A075FNM4 | 6-115 | None |
| A0A075G531 | 69-195 | None |
| A0A4V3ASA3 | 61-183 | None |
| A0A1Q6DUB0 | 546-680 | None |
| A0A1Z8YK89 | 111-223 | None |
| A0A2K2ZYL4 | 128-235 | None |
| A0A3M0XP12 | 1-96 | None |
| A0A453KJF7 | 16-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.