DPCstruct | MC1450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5Z799 | 1-154 | MVNWTTEKDLTLLLGILEFNNVTTSGKTLEYLAQKIGEGCTAKAVSHRLANMKKQAKASAEAAGFEGSPATPDTTPAAKATPKRSRG… |
| A0A6C1M1V5 | 1-123 | MPMTWNAQADARLLLAIIKTSPKIDLKAVVKHMGNECTEKALRHRIGRLQSLAAGDGETSAPTTPTKSPKTPKTRAPVLRATHSSSA… |
| A0A319DQI3 | 15-177 | None |
| U1G939 | 7-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.