DPCstruct | MC145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 169 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M3XY43 | 1-155 | MTWNDFAGGRAVDPATFVAAAGTLLESAVAAAGGGEATRAYFIAGLTASLSVSGPYATLRLDAGLADQDVRNELRENAVAVSEVILD… |
| Q0D0L8 | 44-205 | DKTTPREAWGLKSGLYTPRQLVEGFAPLLDTVVFRLGPDPPNARAARAQLLDNLAANLDTSTREATLRFPDTDIDDSRQEIAEQARS… |
| A0A0C3DSI4 | 8-189 | None |
| B8LWY8 | 1-207 | None |
| A0A2S4KM04 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.