DPCstruct | MC14498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 197 ± 18 aa |
| Standard deviation of domain lengths | 18.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L3AJS4 | 11-200 | TIDRPLTKSQKSEISALSSRVRVTSHSASFVYSYGDFRGDPEQLMRDYFDAMLYMANWGARRLMFRITQTLIDMKKVGRYCISDEIN… |
| A0A3N1T924 | 231-420 | GRHWYYEFRTIERHLNDQQMLELRAALPWAEVTSESVVLDQWSDWAEHPVAGSAAEIVCKYFDAGLRFSQEGTRTLWLRLPGTLAPQ… |
| A0A133U9R4 | 4-191 | None |
| A0A7X6XIU9 | 16-219 | None |
| A0A1F6PL43 | 2-171 | None |
| A0A229SFP7 | 3-188 | None |
| A0A150QSE4 | 2-177 | None |
| A0A4R3V2R1 | 1-221 | None |
| A0A0M8XZC9 | 2-196 | None |
| Q2S8Q0 | 3-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.