DPCstruct | MC14497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 52 ± 4 aa |
| Standard deviation of domain lengths | 3.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9C069 | 15-70 | AAAAAAFLNAQEITTTDCRGCGAEVSGVNGRYACGVCGWTNHWSEGHNKLPGAEED |
| A0A3N1T6G6 | 30-82 | APAPTITPEITTTRCRGCDAEVHGLDGRYACGLCGWSNHWAEGHRPLPTAENR |
| A0A7W9NXC4 | 1-55 | None |
| A0A397RJG2 | 18-72 | None |
| A0A1V0V0S8 | 12-61 | None |
| A0A7H8J1D2 | 1-50 | None |
| F3ZDZ5 | 46-97 | None |
| A0A7W0YQC5 | 6-52 | None |
| A0A542P2Z0 | 163-219 | None |
| A0A1V4AFL7 | 13-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.