DPCstruct | MC14496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 191 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.58 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0163- CL0288- PF07331 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3Y7G3 | 96-231 | LHITAVGDNLIHEAFIEAGRDNDWNFDFLYENIKDDISSADLASVNQETPLTTDHENAAGYPDFNTPSEVADALADAGFDIVTQATE… |
| A0A1I3QL32 | 6-127 | RIGFTGNVMLGRLVDDRHRGRPPSAVWRSVLERPQGLDALVVNLECCLSSRGQQWRRTNRPFHFRADSDWAVPALEEAGVDVCALAN… |
| A0A1Q7CSR1 | 42-163 | None |
| A0A6B2B946 | 367-516 | None |
| A0A2U2BQH3 | 8-154 | None |
| B6BMZ7 | 422-556 | None |
| B1C1N7 | 29-179 | None |
| A0A7S2MBU2 | 5-173 | None |
| A0A819S384 | 9-163 | None |
| A0A7K2AZI7 | 72-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.