DPCstruct | MC14495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3P4H4 | 1-94 | MTDLAEFVAEAHRNGYANTQADPGPNGGKVITYDRGEYSYRDHYSGSTAFVGHEVVTRDGKPVWGMSYYGDLTHEDADPDDVYAFLR… |
| A0A352KTI2 | 128-207 | DVLDAFLREANLNTYANENVKKASPLRPGSSDYHFEKGDLTYHDTYFGATKFIGEEIVYKSGKVAWGMNYYGFTLNNEIS |
| A0A645I9L5 | 36-115 | None |
| A0A0L6JKZ8 | 19-94 | None |
| A0A7T5RFK6 | 1-100 | None |
| A0A554KAW4 | 1-93 | None |
| A0A4R1X5S5 | 1-80 | None |
| A0A3D5BXE1 | 4-84 | None |
| S3LA27 | 36-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.