DPCstruct | MC14493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4KBB0 | 30-134 | LLKTVTEISIQIERFIDDHQPGFVECRLVDANGQSHTFIEKLPIVTTANLWTDSSYPQAGTIACEIESESIDAAGRKLVQVSTERPW… |
| A0A5P9PQ26 | 130-229 | VAVGDECLAPALALRWYDDEPQPGLVEVRLYDRHHREHQLIGKVPYFDSKEDLDPSSSYPLAVGVPVVVREIHGDTAIVESLHHLDD… |
| A0A7Y6GJI9 | 145-244 | None |
| A0A5D0UT02 | 1-100 | None |
| A0A366HFH3 | 89-189 | None |
| A0A3E0HP25 | 8-99 | None |
| A0A1I1I886 | 2-96 | None |
| A0A1H7K2I0 | 206-313 | None |
| A0A2G7DIJ3 | 87-184 | None |
| A0A561S4V6 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.