DPCstruct | MC14488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4SX47 | 1-115 | MPENFQITFRRDLLAETLWEYGEDDLAEAALRLSEDELRQVQILAVWHHENDPEPETGPQLLAGRIMARAMIEFAERTARDTKRVRR… |
| A0A0Q8PL56 | 13-106 | RPRFSAHIPKQLVASALWDYGEDALAERARTMSEKERLQVETIAAWYEIPEYPLPMAGQRITHNHVAAFSAITLFEGSVRPLARTRR… |
| A0A3D9PQ00 | 14-129 | None |
| A0A7W5P6G5 | 1-94 | None |
| A0A3P3VUJ1 | 4-88 | None |
| A0A661PFA9 | 1-85 | None |
| A0A538JMF6 | 1-96 | None |
| A0A3G9J3Y7 | 230-327 | None |
| A0A399VAF3 | 1-101 | None |
| A0A4P8KSQ5 | 25-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.