DPCstruct | MC14487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1027 |
|---|---|
| Mean domain length (aa) | 149 ± 30 aa |
| Standard deviation of domain lengths | 30.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.75 |
| Pfam Score | 99.27 |
| Assigned Pfam label(s) | PF15679- CL0236- CL0021- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0PKY8 | 3-140 | FSAVLDANVLYSFSVRDTLLRLAELELYRPLWSGRILAEMREALLEHGVTVDQAERLVTAIRDAFEEAEVDEAEIARLEPAMTNDPG… |
| A0A3R9QYL5 | 15-165 | RILQGAKTEKVHYLDTSALVKRYVEEPGSKIIDEIYRDAYKGVGKLAFSCWNIAEAAVVLDKYERKLGLDARKLLRNLLRESSTLSR… |
| A0A437GDQ2 | 1-145 | None |
| A0A3L7PY76 | 2-133 | None |
| A0A3A8ZAA3 | 13-188 | None |
| A0A7K2ALL1 | 11-185 | None |
| A0A2R9T2L9 | 109-260 | None |
| A0A7Y3LLY2 | 2-121 | None |
| A0A2A2Z5K3 | 6-160 | None |
| A0A7C4E0F8 | 39-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.