DPCstruct | MC14486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 180 ± 32 aa |
| Standard deviation of domain lengths | 32.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | PF04213- PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3T2N1 | 2-120 | TALRWGIKKSLHEYVRSAEGSIEVADGARLDGDEVIFPADDGVEGAFTGSVRFLAHGGMMDWRLAAPHLEDGGSIVTIGGRRGARVQ… |
| A0A169S6H3 | 36-219 | AAVATTDDVAVVTAENSLDWGFKASWRNYVTGPWTAGTVDATEGATVNEDGTYNFTLGSGSTYDADSEQGQLNYEGTVRFASALHGF… |
| A0A5C8I9U9 | 145-341 | None |
| A9WRJ6 | 755-926 | None |
| A0A1M7P917 | 10-160 | None |
| A0A1Q8JN04 | 95-297 | None |
| A0A7X6CMJ5 | 195-357 | None |
| A0A3E0D0K2 | 12-134 | None |
| A0A1R4FE36 | 2-177 | None |
| A0A2S9A6I4 | 18-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.